Scaffold Ga0302119_10010753

Overview

Basic Information

• Taxon OID: 3300031606
• Scaffold ID: Ga0302119_10010753
• Source Dataset Name: Marine microbial communities from Western Arctic Ocean, Canada - AG5_Tmax
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3913
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 8 (72.73%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 70.5467
  • Long. (^o): -122.9077
  • Depth (m): 450

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031533	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0302119_100107534	F031533	AGTAGG	MHRDGSTPKKVQAGQVLVTSIKRGGGIGTVGSPSKSGARRALRD