Scaffold Ga0308007_10192735

Overview

Basic Information

• Taxon OID: 3300031599
• Scaffold ID: Ga0308007_10192735
• Source Dataset Name: Marine microbial communities from water near the shore, Antarctic Ocean - #71
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 711
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium TMED56 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.5735
  • Long. (^o): 77.9231
  • Depth (m): 26

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019031	Metagenome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308007_101927351	F019031	N/A	MDFYKRLDKKYYHTDPVEHILGRTFRPVAEYDDLYENQPRFDGFVWTKFKETYNLNCQFHNDLQDVDFSKDITCLWFFRERSDRDAGNDIKLADKVITFQANTLFITPSKEIKIQKRKKFFPR