NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307376_10150069

Scaffold Ga0307376_10150069


Overview

Basic Information
Taxon OID3300031578 Open in IMG/M
Scaffold IDGa0307376_10150069 Open in IMG/M
Source Dataset NameSoil microbial communities from Risofladan, Vaasa, Finland - TR-2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1612
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location NameFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052023Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0307376_101500692F052023AGGGGGMQQRKMIDIPLGTEVRTAIRAPIDGDYKFVKHVVDSKCKPAAKESKVYKFRGELMPLCPKCNKRAVWKLADYKFEIPPDRNKTAYVLKVVRGDRP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.