Basic Information | |
---|---|
Taxon OID | 3300031570 Open in IMG/M |
Scaffold ID | Ga0308144_1010035 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1211 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Western Arctic Ocean | |||||||
Coordinates | Lat. (o) | 77.9995 | Long. (o) | -150.0065 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028525 | Metagenome / Metatranscriptome | 191 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0308144_10100351 | F028525 | GAG | MSRTLKEVRENLLEAAEATKTNLQYIRAKTAKNDHFETRRYIAAEILKDKKLADAYKGLEMVHD |
⦗Top⦘ |