Scaffold Ga0307378_10153825

Overview

Basic Information

• Taxon OID: 3300031566
• Scaffold ID: Ga0307378_10153825
• Source Dataset Name: Soil microbial communities from Risofladan, Vaasa, Finland - UN-1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2314
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → SAR324 cluster → SAR324 cluster bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location

• Location Name: Finland: Risofladan, Vaasa
• Coordinates
  • Lat. (^o): 63.0472
  • Long. (^o): 21.7116
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018007	Metagenome / Metatranscriptome	237	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307378_101538254	F018007	GGA	MFSGWKITNILDVGPCELDTVDGPYSKTGYRLERREDGFAVTVGLMEHITGWSVWEVLGWLNEKQAIPRRYDNAKRY