Scaffold Ga0315548_1000508

Overview

Basic Information

• Taxon OID: 3300031551
• Scaffold ID: Ga0315548_1000508
• Source Dataset Name: Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-110
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 35847
• Total Scaffold Genes: 47
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 31 (65.96%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States

Source Dataset Sampling Location

• Location Name: USA: Massachusetts
• Coordinates
  • Lat. (^o): 42.722
  • Long. (^o): -70.847
  • Depth (m): 1.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076640	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0315548_100050819	F076640	N/A	LESINVLPVVASVLTMDTSEFVFLILPLAALVAILVAVVLYVAGKEDTVQHKEMETLHELMRTGEIDKENYSVALQDLVSKKVIDKDSCERLRKLLEKSL