NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318516_10309176

Scaffold Ga0318516_10309176


Overview

Basic Information
Taxon OID3300031543 Open in IMG/M
Scaffold IDGa0318516_10309176 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)913
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005494Metagenome / Metatranscriptome399Y
F054379Metagenome / Metatranscriptome140Y
F072604Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0318516_103091761F054379AGGAGMPRASWRGFLRLSLVSCPIYLSPATTRTKSIRLRQVWQPASVDVDEDDLPARGEEQQGSAPSAPRLLTDDASPHGDQSAAATRVTLRPHDPETGEEIDKRE
Ga0318516_103091762F072604GGAGGMSEREALARYHDWCASRYRKAATRRLWRSHCIRLVAVPVSIGLATLVLATGTSSFCTWWLPVAQISVPAVDSPYH
Ga0318516_103091763F005494N/ALGGGSGMFREADIRTYDAERDAPAAGQPGRAKTTAPRKAPRSRYAIDPAAIAAGRLPDDTPVVTSEANPHYQKHFDRLFSLAKAGDWGAVRDYEVKGSNSYSKMVARYRQDLLALYAAAEAAQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.