NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0318516_10004032

Scaffold Ga0318516_10004032


Overview

Basic Information
Taxon OID3300031543 Open in IMG/M
Scaffold IDGa0318516_10004032 Open in IMG/M
Source Dataset NameTropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6443
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (55.56%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001868Metagenome / Metatranscriptome624Y
F005101Metagenome / Metatranscriptome412Y
F007168Metagenome / Metatranscriptome356Y
F023771Metagenome / Metatranscriptome208Y

Sequences

Protein IDFamilyRBSSequence
Ga0318516_100040325F001868N/AMAIEFYFTPELHLKDGRIIRDLDDATGFAREQEARPGVDQRDEVSHRMEHAKSREEAHAAAHSFVRWLEKLEILE
Ga0318516_100040326F007168GGAGLSLGQARLLPREIESAAGSRAETVMQEKIGYCRQKAAECAARAQEAADKDTRELFLRFRNSWLNAAKRYESSAPAAPDESPQQRPSSFAPELSARDWHERPNDARTDTTAERLGAA
Ga0318516_100040327F005101GAGMKDELTTILEAMRAAHAELADYLVSGDRNAELTIAKLVGILERREVVRAMRSLRALERPGAPQLALAEAS
Ga0318516_100040329F023771AGAAGGMPLYFFHLSFGDRTVPDEEGVELPNRSAAREEVLAVIRDLADPEVAGNPRRWAGWFLQVADNGGEFLRLPIGHPALEIVTLHTQEPRAGESEVKPTRLAGTVATRGGRRSAMLVEQMAAVRKHTEQLLQRNQQLRQELSSLCIASASIRLHASRVVSLARPASPGGDVYRVANKPPRRSPPHLVLLPRG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.