Scaffold Ga0308143_124054

Overview

Basic Information

• Taxon OID: 3300031540
• Scaffold ID: Ga0308143_124054
• Source Dataset Name: Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 608
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada

Source Dataset Sampling Location

• Location Name: Canada: Western Arctic Ocean
• Coordinates
  • Lat. (^o): 77.9995
  • Long. (^o): -150.0065
  • Depth (m): 20

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030104	Metagenome / Metatranscriptome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308143_1240541	F030104	N/A	VIMAFDDDQEEVIEFIDTSFFNFLTIIILFLCYKFSIHYFAFLDCSVSEGRTVTYIATQFIKDFLNTFSLILRFYVLVMRINIYDIFDDILDSYYVFIIDFDDDEYINELFLSIHGTMFFTNDNHDDRSILLEDENGFVGDLFYLYFLT