Scaffold Ga0307380_10580242

Overview

Basic Information

• Taxon OID: 3300031539
• Scaffold ID: Ga0307380_10580242
• Source Dataset Name: Soil microbial communities from Risofladan, Vaasa, Finland - UN-3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 969
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified bacterial viruses → Synechococcus phage S-EIVl (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location

• Location Name: Finland: Risofladan, Vaasa
• Coordinates
  • Lat. (^o): 63.0472
  • Long. (^o): 21.7116
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003687	Metagenome / Metatranscriptome	473	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307380_105802422	F003687	AGG	MSPASVEHLLTQKVRLLARRESPAIDQELENLRQAALEVFFQWQDGLAKFQDLVPFITLLEKKVDLNRSLLKWEQQHIAD