NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307380_10358157

Scaffold Ga0307380_10358157


Overview

Basic Information
Taxon OID3300031539 Open in IMG/M
Scaffold IDGa0307380_10358157 Open in IMG/M
Source Dataset NameSoil microbial communities from Risofladan, Vaasa, Finland - UN-3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1330
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location
Location NameFinland: Risofladan, Vaasa
CoordinatesLat. (o)63.0472Long. (o)21.7116Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003805Metagenome / Metatranscriptome467Y
F043896Metagenome / Metatranscriptome155Y

Sequences

Protein IDFamilyRBSSequence
Ga0307380_103581572F003805GAGGMRPIEHSTESSFHKAAQDKWLVDLFNRQDYRGLLEAALVLNTLHQIERTKSAWAIREAADNLANQFGLDRDSA
Ga0307380_103581573F043896N/ATKIADWARQSWGEVIVDQARAELLDRLYFWDGRDKKDHPLHGTYTGLYQQYTAN

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.