Scaffold Ga0307388_10437255

Overview

Basic Information

• Taxon OID: 3300031522
• Scaffold ID: Ga0307388_10437255
• Source Dataset Name: Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 853
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): -51.9926
  • Long. (^o): 2.0992
  • Depth (m): 50

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036077	Metatranscriptome	170	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0307388_104372551	F036077	AGGA	MKNYSEPTAVTAGFGLHTRSTSTIRQPLPATSPVPENMLVVQDQHSILQFPETAAVYEYDPGFYTEFVHSNIQEGMESVSMSHLVHPPYTPISPLPDPRDQTASSVRHNSQSLTMAAESARIQKELADLQRRISCLSVAENSNQMAMKRDRLA