Scaffold Ga0307488_10299581

Overview

Basic Information

• Taxon OID: 3300031519
• Scaffold ID: Ga0307488_10299581
• Source Dataset Name: Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1036
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Pelagibacter phage HTVC204P (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine → Extreme Environments Viral Communities From Various Locations

Source Dataset Sampling Location

• Location Name: USA: Alaska
• Coordinates
  • Lat. (^o): 71.3731
  • Long. (^o): -156.5049
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077796	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307488_102995814	F077796	AGGA	MENQILCDKCDILENESKLIETFDNELLCSSCYIKKEFDTENEKGE