Scaffold Ga0308394_1014881

Overview

Basic Information

• Taxon OID: 3300031508
• Scaffold ID: Ga0308394_1014881
• Source Dataset Name: Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2438
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat → Phototrophic Mat Microbial And Viral Communities From Various Hot Springs In Yellowstone National Park, Wyoming, United States

Source Dataset Sampling Location

• Location Name: USA: Wyoming
• Coordinates
  • Lat. (^o): 44.5387
  • Long. (^o): -110.798
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044842	Metagenome / Metatranscriptome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0308394_10148811	F044842	AGGAG	MEEIELWGGIRGNTFRNTQCVRFVGEFLAVVDVARADEWVERCVLYRTEEGRVAVHQMRLSLLEDGVDVAEVYVLPALDAGEGE