Basic Information | |
---|---|
Taxon OID | 3300031507 Open in IMG/M |
Scaffold ID | Ga0307509_10962572 Open in IMG/M |
Source Dataset Name | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 519 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Carnobacteriaceae → Trichococcus | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Washington | |||||||
Coordinates | Lat. (o) | 46.0356 | Long. (o) | -122.86 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036037 | Metagenome | 170 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307509_109625721 | F036037 | N/A | KDTLSMEVGDEKIEFNFHDAMTYPCSNVYSITCYDQVDKCAQQVCDFDSEDGLSVALSYDYDFTKIEEMERHICVSQNVHESALALQALQTVPHDTGVIHPIMDSEWVAPILLVPKKIGIMLEEIQNDAYENARIYKEKTKSLHDRMITRKEFNVGDKVLLYHSRLKLFPGK |
⦗Top⦘ |