Scaffold Ga0170819_18036506

Overview

Basic Information

• Taxon OID: 3300031469
• Scaffold ID: Ga0170819_18036506
• Source Dataset Name: Fir Spring Coassembly Site 11 - Champenoux / Amance forest
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1094
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: France: Champenoux
• Coordinates
  • Lat. (^o): 48.7585
  • Long. (^o): 6.3578

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004916	Metagenome / Metatranscriptome	418	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170819_180365061	F004916	N/A	PVSLFIHTVLKMKTSFVLFGVLALVLASSVLAMDMEMEADAAPCHPQCRWQCDDPSCPAQCHPVCERPKCQVHCEETPCAACKIHCDKPQCNVRCPKDLCESTDCPKCETVCAPAKCRTACTAPNALCTPMCEETKCDWKCKKPTLCPRPKCELVCEKPACAYKKPVKVTPNNTCCACSAANVKASMIQAGEAVSGEAMSFLEVMHHMKHASQVSGEPSCCGCSQ