Scaffold Ga0170819_12023412

Overview

Basic Information

• Taxon OID: 3300031469
• Scaffold ID: Ga0170819_12023412
• Source Dataset Name: Fir Spring Coassembly Site 11 - Champenoux / Amance forest
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1375
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Spartobacteria → Candidatus Xiphinematobacter → unclassified Candidatus Xiphinematobacter → Candidatus Xiphinematobacter sp. Idaho Grape (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: France: Champenoux
• Coordinates
  • Lat. (^o): 48.7585
  • Long. (^o): 6.3578

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020424	Metagenome	224	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170819_120234122	F020424	AGAAG	MRCSRGRWPRQNPGADDPGYTQLSFTRTSGLGAAVAAGEFFHAPGGVDEFLLASEKRMAGGADADFNVSFGRASVINRAARANDIGLLIIGMNVRLHIEKQVQKVVLKPLIRK