Scaffold Ga0272435_1000106

Overview

Basic Information

• Taxon OID: 3300031447
• Scaffold ID: Ga0272435_1000106
• Source Dataset Name: Rock endolithic microbial communities from Victoria Land, Antarctica - Ricker Hills nord
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 149241
• Total Scaffold Genes: 156
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 112 (71.79%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock → Rock Endolithic Microbial Communities From Victoria Land, Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Victoria Land
• Coordinates
  • Lat. (^o): -75.7
  • Long. (^o): 159.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038578	Metagenome / Metatranscriptome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0272435_100010641	F038578	AGG	MAEELVVLRGGSRDGESTSVQEGVRRLLAASDAPGLVEVYEADGTTAHVPGNQEQALVFIHVGQEPAGETPPELQQAAGGS