Basic Information | |
---|---|
Taxon OID | 3300031378 Open in IMG/M |
Scaffold ID | Ga0308145_1026356 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_319_33.10 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 900 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Western Arctic Ocean | |||||||
Coordinates | Lat. (o) | 80.9595 | Long. (o) | -132.1842 | Alt. (m) | Depth (m) | 139 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F012639 | Metagenome / Metatranscriptome | 279 | Y |
F015413 | Metagenome / Metatranscriptome | 255 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0308145_10263562 | F015413 | AGG | VQSTDLEKQVNDLLTTKFEQPEFEQLLPRGILGKDMLIGSAGTALSVQMGNIVGKFLPLGQLPSGTASILAGILMQKFGGSSGTLKKLSEGIIQGGIATAMTPFISGLIPSFNQEVKETTQELNPMVKGVMW |
Ga0308145_10263563 | F012639 | AGGAG | MSSNNSGLVLNCTANYAIAAPIATVSPCVLQTSPVVAGVNELQVPLTENWIATDVYILATGNAAGNPTAVDPVITMDKNRGRILVQTPPLSAMLITSNTRPRFSPQPIGFEGGSIIRMFATSTGLNAGAITLATFFV |
⦗Top⦘ |