NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307442_1001442

Scaffold Ga0307442_1001442


Overview

Basic Information
Taxon OID3300031274 Open in IMG/M
Scaffold IDGa0307442_1001442 Open in IMG/M
Source Dataset NameSalt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-30
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11837
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Sediment Microbial Communities From The Plum Island Ecosystem Lter, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.759Long. (o)-70.891Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005366Metagenome / Metatranscriptome403Y
F007779Metagenome / Metatranscriptome345Y

Sequences

Protein IDFamilyRBSSequence
Ga0307442_100144210F005366GGAGMYPLTLQAEIMRHMLNLAKHMASGDLFESRKKLEEYPLRGDPEVFDNIMRVRAVQDRMWGHEVDDTRNDPWRWSTYIAHSAVRWMRDPHKWTREDTNDFYDAMIETAAICAAAAESISRQRKENGHTFYEPG
Ga0307442_10014422F007779GGGGGMFQTLRQRRDTHRAYQRTVDDCLAVLFCGFPRSLLPSLKQRAGTSGLVRRGQAEGTNARACSVQVAVLLIRKLIGSLSQQERHDLAQAFLENDASNPTYKGFKYMFLVAERLDVSPALVSYLNTEVAGQLRGMSQEAIFNSWVEAQIGSVMGQLRERCLEEAQLKSSLWQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.