Scaffold Ga0170824_114276729

Overview

Basic Information

• Taxon OID: 3300031231
• Scaffold ID: Ga0170824_114276729
• Source Dataset Name: Coassembly Site 11 (all samples) - Champenoux / Amance forest
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1093
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: France: Mazerulles, Grand Est.
• Coordinates
  • Lat. (^o): 48.7585
  • Long. (^o): 6.3578

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031230	Metagenome / Metatranscriptome	183	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170824_1142767292	F031230	GGAGG	MKHGLTGLLLAGATCAFVVATPAVAQVAGNPGDLHSPTVYTSEVRANTYGYTPGSGGPLGPLGVLTAPITGPVTMMTGGGPSGGRCGVNQDFNGRLTAFCGL