Scaffold Ga0307497_10757412

Overview

Basic Information

• Taxon OID: 3300031226
• Scaffold ID: Ga0307497_10757412
• Source Dataset Name: Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 506
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location

• Location Name: USA: Washington
• Coordinates
  • Lat. (^o): 46.0356
  • Long. (^o): -122.86

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077504	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307497_107574122	F077504	AGGA	MTKFRTPTPAELYSLELRARRMRSEALGRLLRDGALAIKAAFERAVSQLRTKGVRHA