Basic Information | |
---|---|
Taxon OID | 3300031226 Open in IMG/M |
Scaffold ID | Ga0307497_10046741 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1497 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Washington | |||||||
Coordinates | Lat. (o) | 46.0356 | Long. (o) | -122.86 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013297 | Metagenome / Metatranscriptome | 272 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0307497_100467412 | F013297 | GAGG | MKWPHHRNLRNRPPTPSKGRGRVQVRIRRAFIASGAEVLSSTQIYDRTHSRRRQSRRKKLPFGVYWRTLKTLRAMCEPVERVPPHGAWLWRLRDGAFSVGAQAMRKEG |
⦗Top⦘ |