NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0307974_1002688

Scaffold Ga0307974_1002688


Overview

Basic Information
Taxon OID3300031211 Open in IMG/M
Scaffold IDGa0307974_1002688 Open in IMG/M
Source Dataset NameSaline water microbial communities from Organic Lake, Antarctica - #784
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12674
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (31.25%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Organic Lake
CoordinatesLat. (o)-68.4563Long. (o)78.1898Alt. (m)Depth (m)3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051608Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0307974_10026881F051608AGGMLCAKAYKMFMRTVQQNVFLILNRVPVTIVTDPELIRPSIPVMTHSFDLKVMARKAKARKCTAEIVGNRLAISFSVIPPAKSNPQRYTKMCVISPHNSAGMVSLMWCQMCQNIPAPNDLF

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.