Scaffold Ga0307496_10103863

Overview

Basic Information

• Taxon OID: 3300031200
• Scaffold ID: Ga0307496_10103863
• Source Dataset Name: Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_S
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 557
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 45.0822
  • Long. (^o): -123.061

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069061	Metagenome / Metatranscriptome	124	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307496_101038632	F069061	N/A	MVFDFRHKNIEGKWKSSGHRKGTDRDAAFASLQEKYGPMPSGRYMSRPRDGRTKNWDLFTHQPEPAEQAPSRR