Scaffold Ga0307500_10066173

Overview

Basic Information

• Taxon OID: 3300031198
• Scaffold ID: Ga0307500_10066173
• Source Dataset Name: Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 907
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil And Ectomycorrhiza Microbial Communities From Populus Trichocarpa Stands In Riparian Zones In The Pacific Northwest, United States

Source Dataset Sampling Location

• Location Name: USA: Oregon
• Coordinates
  • Lat. (^o): 45.6996
  • Long. (^o): -121.669

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073999	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307500_100661731	F073999	N/A	GEMDDHTPQLRNLLLEREALEFLLAHACETLLFYAERGNYNAADDGMEEAAMDALVFIAGADAMSVSEALTVPGEL