Scaffold Ga0170823_17085308

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0170823_17085308

Scaffold Ga0170823_17085308

Overview

Basic Information
Taxon OID	3300031128 Open in IMG/M
Scaffold ID	Ga0170823_17085308 Open in IMG/M
Source Dataset Name	Oak Summer Coassembly Site 11 - Champenoux / Amance forest
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1439
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location Name	France: Champenoux
Coordinates	Lat. (^o)	48.7184	Long. (^o)	6.3471	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045002	Metagenome / Metatranscriptome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0170823_170853083	F045002	N/A	MFRLRRRDWIILTAFIGAGAVGYVVYSKWAEEGLRRTEADMKSNLPLRVDQNTTLVDVKYERTHSIYWYVIDKPDQFDAQETARQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.