NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265760_10000011

Scaffold Ga0265760_10000011


Overview

Basic Information
Taxon OID3300031090 Open in IMG/M
Scaffold IDGa0265760_10000011 Open in IMG/M
Source Dataset NameMetatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)101607
Total Scaffold Genes98 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)80 (81.63%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameNorway: Oslo
CoordinatesLat. (o)59.9979Long. (o)10.7895Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001450Metagenome / Metatranscriptome692Y
F002623Metagenome / Metatranscriptome542Y
F011314Metagenome / Metatranscriptome292Y

Sequences

Protein IDFamilyRBSSequence
Ga0265760_1000001158F011314GGAGMTNVKLHAGYAVQLAGLVALAVGAVLSAHHLAIGASLLGGAAALHVGKIIRTVTF
Ga0265760_1000001169F001450GAGGMTEVMRESKQAPESIRNAVTRAGGLNRYGEPNFRVVWGWSRLAWIGGKWRDTNAEGELLREVIELRQEPKYTPHDRWHVERWVPPEAYGSPEQWYEQTSEFENGVLLPALGPYPARGDYEHSFTLEGPQREFLALTPAICDAVVRAVEWSRGTSATEKRAALVAREERITQKWESDASNALGM
Ga0265760_1000001182F002623GAGMQIRQYTSADCEALRRIHARQGFEYEFPNIDDPLFVSKIVLEDDAGLVAMAALARLTCEMYLLMEPEKGTARQRFERLLFLQRAGAEDLRARGLHDAHAWLPPPIGRRFGRRLEAMGWTRDDEWTPYSIRFAR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.