Scaffold Ga0073961_12230655

Overview

Basic Information

• Taxon OID: 3300031063
• Scaffold ID: Ga0073961_12230655
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_5 metaT (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 811
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002472	Metatranscriptome	556	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0073961_122306551	F002472	GGA	VVENFQGNADVVFGDVALSSDQVRKIHGEDQGAGAGGWPTIRYFNKGTGYGGKPYPKKTSMAMCDELGPKEEYMQQYVEEMGGTSLCSVKNTESGCTDKQKTFIEKWNTKPSDEIGKQLERLQGMVDKNSESMKPDALSWAKQRLNIFKQLSKKDEL