Scaffold Ga0138346_10814946

Overview

Basic Information

• Taxon OID: 3300031056
• Scaffold ID: Ga0138346_10814946
• Source Dataset Name: Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 733
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location

• Location Name: Southern Atlantic ocean
• Coordinates
  • Lat. (^o): -5.7
  • Long. (^o): -26.0
  • Depth (m): 150

Associated Families

Family	Category	Number of Sequences	3D Structure?
F037558	Metatranscriptome	167	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138346_108149461	F037558	N/A	VGSFNTLPAALNRGNVANFWANSIINNRQRRQATDGLLETDEEDFQEFLEDFEDYKEDMGHKMGNLTCVMTKMEMLDSSLQVNLAEYTGGFWDKIDLSKTLAGSDPVWRQMMTSGYTDCYSIAQTFPKEALEKNPVTKVFGRHMIFFKCAAKVEKKCCYQAQMYDWIKTMYGDDPSFNWAQYGFPTNKYDRATMAIKVLTETASDEEEFVGNFFYGDSDM