Basic Information | |
---|---|
Taxon OID | 3300031056 Open in IMG/M |
Scaffold ID | Ga0138346_10155529 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S12_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 523 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Atlantic ocean | |||||||
Coordinates | Lat. (o) | -5.7 | Long. (o) | -26.0 | Alt. (m) | Depth (m) | 150 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019416 | Metatranscriptome | 229 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0138346_101555291 | F019416 | N/A | MTFKAISYFIDLKSDDNASDTSPPTSARGHLKAIQCAKRDLLMSFPGARRLVCRKRLTEATKFLEKQGASDKDLCICLYVSGSELPAKLPYMSRDMSVKCTDDSDLLAEYLLNDEPVRVQIMKFNVRVESFAPPANQIGRWKKPEA |
⦗Top⦘ |