Scaffold Ga0074029_1233473

Overview

Basic Information

• Taxon OID: 3300031051
• Scaffold ID: Ga0074029_1233473
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C1 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 619
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Hordeinae → Hordeum → Hordeum vulgare → Hordeum vulgare subsp. vulgare (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: Sweden: Dalarna County
• Coordinates
  • Lat. (^o): 60.97
  • Long. (^o): 15.87

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064333	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074029_12334731	F064333	N/A	DFEKSFRDLDSFGRSYWQLYPALKKVDEMYEPLYLLREIFPDIWPWNLIWKGHDSLFTHIDNAVFTWEQAMLKDKNAELAEPIKRDVIIKYRHDTDIAVMKYYASILRTIILPPFEAAVHPVTKHIIEPLAEAIPQPLREFIDIKQMFEDLYIGIVEDSIQVVLRADGPDDAFRSKLA