NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0074029_1007596

Scaffold Ga0074029_1007596


Overview

Basic Information
Taxon OID3300031051 Open in IMG/M
Scaffold IDGa0074029_1007596 Open in IMG/M
Source Dataset NameMetatranscriptome of forest soil microbial communities from Dalarna County, Sweden - Site 2 - Humus C1 (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)655
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameSweden: Dalarna County
CoordinatesLat. (o)60.97Long. (o)15.87Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001514Metagenome / Metatranscriptome679Y

Sequences

Protein IDFamilyRBSSequence
Ga0074029_10075961F001514N/AEKGLKPTKELLDPCRKDLTDPILPFILKGNTSGVEEWFRGNAYIAHHFCRAHGLLLETGKLFVVIEKAANAAKTGGTLLVFGLANAQLNATLDSTKAIMDAVKEEFNNVSKIAECCFEELVFANQATKERTEWITHFKNVFPGINEINESVKTIQRDVAEIKQTANSMSLYDRFQKAADENAEFLNTADNFSQRMSEVCGTPYVKPKPKELTADDTQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.