Scaffold Ga0138301_1411582

Overview

Basic Information

• Taxon OID: 3300031022
• Scaffold ID: Ga0138301_1411582
• Source Dataset Name: Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 514
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: South-western Pyrenees, Aspurz, Spain
• Coordinates
  • Lat. (^o): 42.0
  • Long. (^o): 1.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103579	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138301_14115821	F103579	AGGAG	MRNRFMDLLATFAMMLAFSAVTFAQTYGTKGYSPGAWKPEELPKELSKPKPYNSHD