Scaffold Ga0138298_1455322

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0138298_1455322

Scaffold Ga0138298_1455322

Overview

Basic Information
Taxon OID	3300031015 Open in IMG/M
Scaffold ID	Ga0138298_1455322 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	567
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location Name	South-western Pyrenees, Aspurz, Spain
Coordinates	Lat. (^o)	42.0	Long. (^o)	1.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006045	Metagenome / Metatranscriptome	382	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138298_14553221	F006045	N/A	TKKSNTRLIITLKHIRTELKNLDFFYEKKTIPTLTEGGRVTLRLGGDGATLSFNFEIQQGPEDKVPRLAEGEVHFNIHQLDIEYDKDSLKHDILVPLVTAMFKQQIQIEIERNVEKSFKNLMKPIGEQLMDGLSQVNRPILSGLSKVREVVKGSQVGQVYEKRREMLE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.