Scaffold Ga0073994_12292365

Overview

Basic Information

• Taxon OID: 3300030991
• Scaffold ID: Ga0073994_12292365
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 637
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: USA: Montana
• Coordinates
  • Lat. (^o): 45.7544
  • Long. (^o): -113.9094

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083302	Metagenome / Metatranscriptome	113	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0073994_122923651	F083302	N/A	FFVAVAAGLSLAGLLLWALRGASQRRSYDRGPGALNKTPHHLNNMAQIRRAMDPADFDFVKERAGRALSARLRRERRKVVLLYLAAVRSDFQQSLRVARVIAVLSPEVSGSHEYERIRLAMIFRWRFQMIKVRLVMGIIPQPQFVTLWQMAASMAMQMEENMAKLGERAALASELAMQSE