Basic Information | |
---|---|
Taxon OID | 3300030991 Open in IMG/M |
Scaffold ID | Ga0073994_12201187 Open in IMG/M |
Source Dataset Name | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1874 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Montana | |||||||
Coordinates | Lat. (o) | 45.7544 | Long. (o) | -113.9094 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029272 | Metagenome / Metatranscriptome | 189 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0073994_122011871 | F029272 | GGAG | MTCEEFERVLPELGSGHNTEQEEHLKSCRACSDLVADLNAISQQGRLLQASEEPSPWVWNSIEVALRQEGLIRQSQQGHSLIHPPRLNWKLRWLVPAAATLL |
⦗Top⦘ |