Scaffold Ga0099845_1597361

Overview

Basic Information

• Taxon OID: 3300030975
• Scaffold ID: Ga0099845_1597361
• Source Dataset Name: Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 562
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil → Forest Soil Eukaryotic Communities From Alaska, Usa, For A Soil Warming Experiment In A Boreal Forest

Source Dataset Sampling Location

• Coordinates
  • Lat. (^o): 63.883
  • Long. (^o): -145.733

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080934	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099845_15973611	F080934	N/A	LLLLLLASNFRPARINAPKRASRLTPDRNLFLGTAFRSLEKTARYRATFPRSVFLAYPFGSPLSLSRTRSIQPLIHAIRLAPDGANSLRRTRCPSPSERPRSFFRPSLPFRAFWTPPDQSVDLNTNREVHQIETPDLFRSPLPAVLIDQQRINVPDSLRPV