Scaffold Ga0138300_1582276

Overview

Basic Information

• Taxon OID: 3300030922
• Scaffold ID: Ga0138300_1582276
• Source Dataset Name: Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_OS_autumn Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 628
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Amoebozoa → Discosea → Longamoebia → Centramoebida → Acanthamoebidae → Acanthamoeba → Acanthamoeba castellanii → Acanthamoeba castellanii str. Neff (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: South-western Pyrenees, Aspurz, Spain
• Coordinates
  • Lat. (^o): 42.0
  • Long. (^o): 1.0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F096486	Metagenome / Metatranscriptome	104	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0138300_15822761	F096486	N/A	MEMLALEWGGRAGALWDVAKLEPCCGDPCNPADGVKCVACWYIFATCSLSKLFAHSVGQDCAVVNHVLPTFFCSSCVSIAVRHNIRVKHGAGPKAGDIMGIIGDVLVLNFCGPCAFCQILRAVDNDTWDWLGHIQSKQIKVMDDPFIFLTSSGGGEHQTIV