NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073951_11220663

Scaffold Ga0073951_11220663


Overview

Basic Information
Taxon OID3300030921 Open in IMG/M
Scaffold IDGa0073951_11220663 Open in IMG/M
Source Dataset NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_5 metaT (Eukaryote Community Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)546
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Source Dataset Sampling Location
Location NameSouthern Atlantic ocean
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F028703Metatranscriptome190Y

Sequences

Protein IDFamilyRBSSequence
Ga0073951_112206631F028703N/AMGDQYADVTIRDFGPAGNPAGRLQPLEASGLKAGKWILEPKTGNPCTVAEQPKKSKTGKHGSAKITCKLKMGYSAKTAQLMAPGHQQLEGCVIEKLEYTYSYMEGDPEDKDTDVITIFCLDEANNESELKLARARSKVWEKVINVINEGEEAGDEICLVVQEGPKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.