Scaffold Ga0074005_13782665

Overview

Basic Information

• Taxon OID: 3300030908
• Scaffold ID: Ga0074005_13782665
• Source Dataset Name: Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Litter TCEFA (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 607
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Staphylococcaceae → Staphylococcus → Staphylococcus aureus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: USA: Montana
• Coordinates
  • Lat. (^o): 46.9233
  • Long. (^o): -110.871944

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078199	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0074005_137826651	F078199	N/A	GYDFEIIYKKKKQNVVADALSKKKDEDVEALVCVISIIQPDWINETREE