Scaffold Ga0315890_100183

Overview

Basic Information

• Taxon OID: 3300030819
• Scaffold ID: Ga0315890_100183
• Source Dataset Name: Metatranscriptome of plant litter microbial communities from East Loma Ridge, Irvine, California - P2 T34 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2411
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae → Ourmiavirus → unclassified Ourmiavirus → Erysiphe necator associated ourmia-like virus 88 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Plant Litter Microbial Communities From East Loma Ridge, Irvine, California

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 33.7417
  • Long. (^o): -117.7042
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078016	Metatranscriptome	116	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0315890_1001831	F078016	AGGA	VAGRLKGCVVGTGLFREKVQTFLLRNITTGVFATQRSLRRGLGCVLSSRVIRWAQLDKREDFYLSFPSEPSVPLRKRLWMHNSIPLGYVRCAGVTDDESFSFNMIETAWSRPPIAGKKQSDDEYWDYVREGTYRYVPFSAYRFWTMAGGVGTLPKPQLQCRRPEKMGWKKQREGGIAFVSAGLLGG