Basic Information | |
---|---|
Taxon OID | 3300030811 Open in IMG/M |
Scaffold ID | Ga0265735_105742 Open in IMG/M |
Source Dataset Name | Metatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLA1 (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 581 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Norway: Oslo | |||||||
Coordinates | Lat. (o) | 59.9979 | Long. (o) | 10.7895 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F006257 | Metagenome / Metatranscriptome | 377 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0265735_1057421 | F006257 | N/A | FQVTRFPALLTTGMHGTEHCVQERWMSRRSAPPRPISLPQDHCFPAQRSFSPLRSRPLVTAFPSPATAAPSQRPPFRGQRSRPATSRPASSFPRPVRLSAPLPSPVRPVASSFFASGPLRLFSLARLAASPVSTPLRDFCIPRDQSVQQVPPPLGSPSESARLPLAPRNRFYF |
⦗Top⦘ |