NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265720_1004522

Scaffold Ga0265720_1004522


Overview

Basic Information
Taxon OID3300030764 Open in IMG/M
Scaffold IDGa0265720_1004522 Open in IMG/M
Source Dataset NameMetatranscriptome of plant litter microbial communities from Maridalen valley, Oslo, Norway - NLI1 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)787
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameNorway: Oslo
CoordinatesLat. (o)59.9979Long. (o)10.7895Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031875Metagenome / Metatranscriptome181N
F037987Metagenome / Metatranscriptome167Y

Sequences

Protein IDFamilyRBSSequence
Ga0265720_10045221F031875GAGVLMRSSNLTPFGDCDSSVLETCPDYLTQLAAVSNRDSLRDPSFAFDDVRTPPEESVNSASPNFRSVQRSRGNQPAPTFPRSPGIILKRLILILLSTTVSCF
Ga0265720_10045222F037987N/ALFPEPALGAPFSGAAGFPTPFSTASGVIGLVAGPSGDFHHADFE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.