Scaffold Ga0265762_1005358

Overview

Basic Information

• Taxon OID: 3300030760
• Scaffold ID: Ga0265762_1005358
• Source Dataset Name: Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2298
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Norway: Oslo
• Coordinates
  • Lat. (^o): 59.9992
  • Long. (^o): 10.7901

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062809	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265762_10053582	F062809	GGAGG	VKRPGPQQLSLAVSCLVGVLVAVQNTKGFDGTEFGGGWLTGPLLSIANIGIVLFLLALIAAFVLRRVAAGIGFASSVLCLPLYLYLIAPVLFIHVFDVGHKCKVQPSSGFHGSGWAIAGVLTLAATMYVCMRNLAVPDTV