NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0265460_11634983

Scaffold Ga0265460_11634983


Overview

Basic Information
Taxon OID3300030740 Open in IMG/M
Scaffold IDGa0265460_11634983 Open in IMG/M
Source Dataset NameForest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)651
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location
Location NameCanada: Quebec
CoordinatesLat. (o)47.265Long. (o)-71.2174Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038006Metagenome / Metatranscriptome166N

Sequences

Protein IDFamilyRBSSequence
Ga0265460_116349832F038006AGGMDSVKELFAIRNRAVCPSLFLASRVSDSLLIYNHLHRGYWRNLTVVNAGSKTLGADEFEVHQMKAVTIKTPLKSMAALAYYASAPRPDIVPVINLIKCNAVVTRKLMLALEFRDFEFMICSRIWQNWYKDITLVDAQIAALGKGAD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.