Scaffold Ga0265462_10137026

Overview

Basic Information

• Taxon OID: 3300030738
• Scaffold ID: Ga0265462_10137026
• Source Dataset Name: Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VDE Co-assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1196
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From France, Sweden, Spain And Usa, For Metatranscriptomics Studies

Source Dataset Sampling Location

• Location Name: Canada: Quebec
• Coordinates
  • Lat. (^o): 47.2641
  • Long. (^o): -71.2157

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090634	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0265462_101370261	F090634	N/A	HEMQVRLVIFDDPSPGLGTAVPLRGAEIGASSSAGLSAMLAFLNQQTTYQPSHFGEIRIASGQVVTMQYGSPGPLGMNGP