Scaffold Ga0307921_1011277

Overview

Basic Information

• Taxon OID: 3300030712
• Scaffold ID: Ga0307921_1011277
• Source Dataset Name: Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-3 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 928
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Steroidobacteraceae → unclassified Steroidobacteraceae → Steroidobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Clay → Unclassified → Soil → Soil Microbial Communities From Risofladan, Vaasa, Finland

Source Dataset Sampling Location

• Location Name: Finland: Risofladan, Vaasa
• Coordinates
  • Lat. (^o): 63.0472
  • Long. (^o): 21.7116
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035666	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307921_10112772	F035666	AGG	MIAGDLYLGWLCKNRSCGLVIAIALPPPGSKAASTDFDDQLTAIQCPHCGDEDLYRWSTRSEQKYTPKGVGT