Scaffold Ga0307399_10389841

Overview

Basic Information

• Taxon OID: 3300030702
• Scaffold ID: Ga0307399_10389841
• Source Dataset Name: Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 674
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Chrysophyceae → Chromulinales → Chromulinaceae → Spumella → Spumella elongata (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -68.012
  • Long. (^o): -0.0106
  • Depth (m): 33

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012644	Metatranscriptome	278	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0307399_103898411	F012644	N/A	FWLKLFQLLSGQFCKGVAVPGCCHNIVAAMKICAIALVAAMGALPTECANLLRSQVAQEPDTSCGKGFDNIIDGSKAYFGTAMEKLWSHPSHQMDKSTFEPEFKCWFANMMTTKCGGLKSQADTRKKELTAKCLDPQVAFPAVWSMFSTEELMYFKKNYPAVEDEDAKGIFNKQVMHTAKELNKKEVLCMTLFAIDDKCVEWPHIRLG