Scaffold Ga0307402_10501518

Overview

Basic Information

• Taxon OID: 3300030653
• Scaffold ID: Ga0307402_10501518
• Source Dataset Name: Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 704
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium → Alexandrium monilatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Southern Ocean
• Coordinates
  • Lat. (^o): -70.3658
  • Long. (^o): -8.2821
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059565	Metatranscriptome	133	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0307402_105015181	F059565	N/A	LPAMMRIVLLCLVAGAGAQKTDSLKEMVMSSKVFKAKEATFCAHTKPQMKSACQGELLCKIIRRSGPKAAAASRANGCDLMHPRAFMQIDQKIAHKAPEDQLAKEMTHDLEMNFNKIAPFGKEDTAKELQDHASKTQDTLVDAVENAEVAEIKRAVFRALTRLRAATIKEFDTIARLETQAIDAYNDAHHYRAENPLAHLHEDEAPVETDKLKSFH